PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3242_f_8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 635aa    MW: 70268.3 Da    PI: 8.5393
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3242_f_8genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B365.21e-2079166183
                    EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83 
                    f+k+lt sd++++g +++ +k+a e+       +     +++l  +d++g +W++k+iyr++++r++lt+GW+ Fv +++L +gD +vF 
  Neem_3242_f_8  79 FCKILTASDTSTHGGFSVLRKHAMEClpqldltQTT--PTQELAAKDLHGYEWRFKHIYRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL 166
                    99****************************864333..4459***********************************************7 PP

2Auxin_resp104.81.1e-34188267183
     Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                    aaha++t++ F v+Y+Pr+  s+F++ ++k+++a ++ +svGmRfkm+fe+eds+err++Gt+vgv d  +v+Wp+SkWrsLk
  Neem_3242_f_8 188 AAHAVKTQTLFVVYYKPRT--SQFIIGLNKYLEAANHGFSVGMRFKMRFEGEDSPERRFTGTIVGVGD-FSVQWPGSKWRSLK 267
                    79****************6..9**********************************************.566*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-3570191IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.5E-3372186IPR015300DNA-binding pseudobarrel domain
CDDcd100174.91E-1777165No hitNo description
PfamPF023627.1E-1979166IPR003340B3 DNA binding domain
PROSITE profilePS5086310.6379188IPR003340B3 DNA binding domain
SMARTSM010194.9E-1479188IPR003340B3 DNA binding domain
PfamPF065074.3E-33188267IPR010525Auxin response factor
PfamPF023091.9E-11499608IPR033389AUX/IAA domain
SuperFamilySSF542771.05E-12515596No hitNo description
PROSITE profilePS5174524.401520601IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 635 aa     Download sequence    Send to blast
MAHVEANLRG SSISRAETGS GSGDLYTELW KACAGPLVDV PRSGERVFYF PQGHIEQQSE  60
PRSPDACPPE PPKRTVHSFC KILTASDTST HGGFSVLRKH AMECLPQLDL TQTTPTQELA  120
AKDLHGYEWR FKHIYRGQPR RHLLTTGWST FVTSKRLVAG DAFVFLRAPM PSSVISSQSM  180
HLGVLATAAH AVKTQTLFVV YYKPRTSQFI IGLNKYLEAA NHGFSVGMRF KMRFEGEDSP  240
ERRFTGTIVG VGDFSVQWPG SKWRSLKIQW DEPATIQRPE RVSPWEIEPF VASAPLNLAQ  300
PAGKSKRPRS TDIPASEITT NSASSAFWYQ GSTQSHELTQ LGSTAEVQSS ESQVVWPMRQ  360
KEIDGNLVNS SNGSNTKITS EGMWPSSPRL NVSLNLFPDS RNDTKIVAAR STLSGYASAR  420
SSNGLIHNHV EKGKKSDTPT VCRLFGIDLK HNSNIVARLV KEVADPSIDS SSIKGPRAAC  480
DNDKAQNQDA LNSSKEMKQM TAEALPKETL NKQGSTASTR TRTKVQMQGI AVGRAVDLTV  540
LNGYNDLVDE LEKMFEIQGQ LRTREKWAVV FTDDEGDMML AGDDPWLEFC KMVKKIFIYS  600
SEEVRKMTTR CKLTASTVEG EGTVISLDSE HRSDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1241929013355Auxin response factor 1
4ldw_A1e-1241929013355Auxin response factor 1
4ldw_B1e-1241929013355Auxin response factor 1
4ldx_A1e-1241929013355Auxin response factor 1
4ldx_B1e-1241929013355Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006491295.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A067HEU10.0A0A067HEU1_CITSI; Auxin response factor
STRINGVIT_15s0046g00290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18